Lineage for d1vyra_ (1vyr A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2827846Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2828250Protein Pentaerythritol tetranirate reductase [63900] (1 species)
  7. 2828251Species Enterobacter cloacae [TaxId:550] [63901] (33 PDB entries)
    Uniprot P71278
  8. 2828252Domain d1vyra_: 1vyr A: [108906]
    complexed with fmn, tnf
    has additional insertions and/or extensions that are not grouped together

Details for d1vyra_

PDB Entry: 1vyr (more details), 0.9 Å

PDB Description: Structure of pentaerythritol tetranitrate reductase complexed with picric acid
PDB Compounds: (A:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d1vyra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
aeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqi
saqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvs
asalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelh
sahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfq
nvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigag
aytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdy
psl

SCOPe Domain Coordinates for d1vyra_:

Click to download the PDB-style file with coordinates for d1vyra_.
(The format of our PDB-style files is described here.)

Timeline for d1vyra_: