SCOPe 2.06: Domain d1vypx_: 1vyp X:

Lineage for d1vypx_ (1vyp X:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein Pentaerythritol tetranirate reductase [63900] (1 species)

7. Species Enterobacter cloacae [TaxId:550] [63901] (29 PDB entries)
   Uniprot P71278

8. Domain d1vypx_: 1vyp X: [108905]
   complexed with fmn, tnf; mutant

Details for d1vypx_

PDB Entry: 1vyp, 1.27 Å

PDB Description: structure of pentaerythritol tetranitrate reductase w102f mutant and complexed with picric acid

PDB Compounds: (X:) Pentaerythritol tetranitrate reductase

SCOPe Domain Sequences for d1vypx_:

Sequence; same for both SEQRES and ATOM records:

>d1vypx_ c.1.4.1 (X:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]}
eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
aqakgyagapglhspeqiaawkkitagvhaedgriavqlfhtgrishssiqpggqapvsa
salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
sl

Timeline for d1vypx_:

• d1vypx_ first appeared in SCOP 1.69
  
• d1vypx_ appears in SCOPe 2.05
  
• d1vypx_ appears in SCOPe 2.07
  
• d1vypx_ appears in the current release, SCOPe 2.08