Lineage for d1vyna_ (1vyn A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1122015Superfamily b.34.14: PAZ domain [101690] (1 family) (S)
  5. 1122016Family b.34.14.1: PAZ domain [101691] (6 proteins)
  6. 1122020Protein Argonaute 2 [101692] (1 species)
  7. 1122021Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101693] (4 PDB entries)
    Uniprot Q9VUQ5 602-717 ! Uniprot Q9VUQ5 602-720
  8. 1122023Domain d1vyna_: 1vyn A: [108904]

Details for d1vyna_

PDB Entry: 1vyn (more details)

PDB Description: structure and nucleic acid binding of the drosophila argonaute2 paz domain
PDB Compounds: (A:) argonaute2

SCOPe Domain Sequences for d1vyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vyna_ b.34.14.1 (A:) Argonaute 2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ampmieylerfslkakinnttnldysrrflepflrginvvytppqsfqsaprvyrvngls
rapassetfehdgkkvtiasyfhsrnyplkfpqlhclnvgssiksillpielcsiee

SCOPe Domain Coordinates for d1vyna_:

Click to download the PDB-style file with coordinates for d1vyna_.
(The format of our PDB-style files is described here.)

Timeline for d1vyna_: