Lineage for d1vyga_ (1vyg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804862Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 2805096Protein Fatty acid-binding protein Sm14 [110276] (1 species)
  7. 2805097Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110277] (2 PDB entries)
    Uniprot P29498
  8. 2805099Domain d1vyga_: 1vyg A: [108903]
    complexed with acd

Details for d1vyga_

PDB Entry: 1vyg (more details), 2.4 Å

PDB Description: schistosoma mansoni fatty acid binding protein in complex with arachidonic acid
PDB Compounds: (A:) fatty acid binding protein

SCOPe Domain Sequences for d1vyga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vyga_ b.60.1.2 (A:) Fatty acid-binding protein Sm14 {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
gsmssflgkwklseshnfdavmsklgvswatrqigntvtptvtftmdgdkmtmltestfk
nlsctfkfgeefdektsdgrnvksvveknseskltqtqvdpknttvivrevdgdtmkttv
tvgdvtairnykrls

SCOPe Domain Coordinates for d1vyga_:

Click to download the PDB-style file with coordinates for d1vyga_.
(The format of our PDB-style files is described here.)

Timeline for d1vyga_: