Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
Protein Fatty acid-binding protein Sm14 [110276] (1 species) |
Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110277] (2 PDB entries) Uniprot P29498 |
Domain d1vyga_: 1vyg A: [108903] complexed with acd |
PDB Entry: 1vyg (more details), 2.4 Å
SCOPe Domain Sequences for d1vyga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vyga_ b.60.1.2 (A:) Fatty acid-binding protein Sm14 {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} gsmssflgkwklseshnfdavmsklgvswatrqigntvtptvtftmdgdkmtmltestfk nlsctfkfgeefdektsdgrnvksvveknseskltqtqvdpknttvivrevdgdtmkttv tvgdvtairnykrls
Timeline for d1vyga_: