Lineage for d1vyfa_ (1vyf A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467811Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 467812Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 468030Family b.60.1.2: Fatty acid binding protein-like [50847] (16 proteins)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 468112Protein Fatty acid-binding protein Sm14 [110276] (1 species)
  7. 468113Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110277] (2 PDB entries)
  8. 468114Domain d1vyfa_: 1vyf A: [108902]

Details for d1vyfa_

PDB Entry: 1vyf (more details), 1.85 Å

PDB Description: schistosoma mansoni fatty acid binding protein in complex with oleic acid

SCOP Domain Sequences for d1vyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vyfa_ b.60.1.2 (A:) Fatty acid-binding protein Sm14 {Blood fluke (Schistosoma mansoni)}
gsmssflgkwklseshnfdavmsklgvswatrqigntvtptvtftmdgdkmtmltestfk
nlsctfkfgeefdektsdgrnvksvveknseskltqtqvdpknttvivrevdgdtmkttv
tvgdvtairnykrls

SCOP Domain Coordinates for d1vyfa_:

Click to download the PDB-style file with coordinates for d1vyfa_.
(The format of our PDB-style files is described here.)

Timeline for d1vyfa_: