![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (5 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.2: Fatty acid binding protein-like [50847] (16 proteins) ten-stranded meander beta-sheet folded upon itself relates to the common fold by opening the barrel and insertion of beta-hairpin |
![]() | Protein Fatty acid-binding protein Sm14 [110276] (1 species) |
![]() | Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [110277] (2 PDB entries) |
![]() | Domain d1vyfa_: 1vyf A: [108902] |
PDB Entry: 1vyf (more details), 1.85 Å
SCOP Domain Sequences for d1vyfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vyfa_ b.60.1.2 (A:) Fatty acid-binding protein Sm14 {Blood fluke (Schistosoma mansoni)} gsmssflgkwklseshnfdavmsklgvswatrqigntvtptvtftmdgdkmtmltestfk nlsctfkfgeefdektsdgrnvksvveknseskltqtqvdpknttvivrevdgdtmkttv tvgdvtairnykrls
Timeline for d1vyfa_: