Lineage for d1vydb_ (1vyd B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 633825Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 633836Protein Cytochrome c2 [46650] (8 species)
  7. 633840Species Rhodobacter capsulatus [TaxId:1061] [46652] (3 PDB entries)
  8. 633842Domain d1vydb_: 1vyd B: [108901]
    complexed with hem; mutant

Details for d1vydb_

PDB Entry: 1vyd (more details), 2.3 Å

PDB Description: crystal structure of cytochrome c2 mutant g95e
PDB Compounds: (B:) cytochrome c2

SCOP Domain Sequences for d1vydb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vydb_ a.3.1.1 (B:) Cytochrome c2 {Rhodobacter capsulatus [TaxId: 1061]}
gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
gasgfawteediatyvkdpgaflkeklddkkaktemafklakggedvaaylasvvk

SCOP Domain Coordinates for d1vydb_:

Click to download the PDB-style file with coordinates for d1vydb_.
(The format of our PDB-style files is described here.)

Timeline for d1vydb_: