Lineage for d1vydb_ (1vyd B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532347Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 532348Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 532349Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 532360Protein Cytochrome c2 [46650] (8 species)
  7. 532364Species Rhodobacter capsulatus [TaxId:1061] [46652] (3 PDB entries)
  8. 532366Domain d1vydb_: 1vyd B: [108901]
    complexed with hem; mutant

Details for d1vydb_

PDB Entry: 1vyd (more details), 2.3 Å

PDB Description: crystal structure of cytochrome c2 mutant g95e

SCOP Domain Sequences for d1vydb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vydb_ a.3.1.1 (B:) Cytochrome c2 {Rhodobacter capsulatus}
gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
gasgfawteediatyvkdpgaflkeklddkkaktemafklakggedvaaylasvvk

SCOP Domain Coordinates for d1vydb_:

Click to download the PDB-style file with coordinates for d1vydb_.
(The format of our PDB-style files is described here.)

Timeline for d1vydb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vyda_