SCOPe 2.06: Domain d1vyda_: 1vyd A:

Lineage for d1vyda_ (1vyd A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodobacter capsulatus [TaxId:1061] [46652] (3 PDB entries)
   Uniprot P00094

8. Domain d1vyda_: 1vyd A: [108900]
   complexed with hem; mutant

Details for d1vyda_

PDB Entry: 1vyd, 2.3 Å

PDB Description: crystal structure of cytochrome c2 mutant g95e

PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d1vyda_:

Sequence; same for both SEQRES and ATOM records:

>d1vyda_ a.3.1.1 (A:) Cytochrome c2 {Rhodobacter capsulatus [TaxId: 1061]}
gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
gasgfawteediatyvkdpgaflkeklddkkaktemafklakggedvaaylasvvk

Timeline for d1vyda_:

• d1vyda_ first appeared in SCOP 1.69
  
• d1vyda_ appears in SCOPe 2.05
  
• d1vyda_ appears in SCOPe 2.07
  
• d1vyda_ appears in the current release, SCOPe 2.08