Lineage for d1vyda_ (1vyd A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437666Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 437667Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 437668Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 437679Protein Cytochrome c2 [46650] (8 species)
  7. 437683Species Rhodobacter capsulatus [TaxId:1061] [46652] (3 PDB entries)
  8. 437684Domain d1vyda_: 1vyd A: [108900]

Details for d1vyda_

PDB Entry: 1vyd (more details), 2.3 Å

PDB Description: crystal structure of cytochrome c2 mutant g95e

SCOP Domain Sequences for d1vyda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vyda_ a.3.1.1 (A:) Cytochrome c2 {Rhodobacter capsulatus}
gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
gasgfawteediatyvkdpgaflkeklddkkaktemafklakggedvaaylasvvk

SCOP Domain Coordinates for d1vyda_:

Click to download the PDB-style file with coordinates for d1vyda_.
(The format of our PDB-style files is described here.)

Timeline for d1vyda_: