Lineage for d1vyda_ (1vyd A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980370Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 1980381Protein Cytochrome c2 [46650] (8 species)
  7. 1980385Species Rhodobacter capsulatus [TaxId:1061] [46652] (3 PDB entries)
    Uniprot P00094
  8. 1980386Domain d1vyda_: 1vyd A: [108900]
    complexed with hem; mutant

Details for d1vyda_

PDB Entry: 1vyd (more details), 2.3 Å

PDB Description: Crystal structure of cytochrome c2 mutant G95E
PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d1vyda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vyda_ a.3.1.1 (A:) Cytochrome c2 {Rhodobacter capsulatus [TaxId: 1061]}
gdaakgekefnkcktchsiiapdgteivkgaktgpnlygvvgrtagtypefkykdsival
gasgfawteediatyvkdpgaflkeklddkkaktemafklakggedvaaylasvvk

SCOPe Domain Coordinates for d1vyda_:

Click to download the PDB-style file with coordinates for d1vyda_.
(The format of our PDB-style files is described here.)

Timeline for d1vyda_: