Lineage for d1vybb_ (1vyb B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512728Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 512729Superfamily d.151.1: DNase I-like [56219] (2 families) (S)
  5. 512730Family d.151.1.1: DNase I-like [56220] (6 proteins)
  6. 512755Protein Endonuclease domain of LINE-1 reverse transcriptase homolog [111211] (1 species)
  7. 512756Species Human (Homo sapiens) [TaxId:9606] [111212] (1 PDB entry)
  8. 512758Domain d1vybb_: 1vyb B: [108898]
    94% sequence identity

Details for d1vybb_

PDB Entry: 1vyb (more details), 1.8 Å

PDB Description: endonuclease domain of human line1 orf2p

SCOP Domain Sequences for d1vybb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vybb_ d.151.1.1 (B:) Endonuclease domain of LINE-1 reverse transcriptase homolog {Human (Homo sapiens)}
shitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwrkiyqa
ngkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntgaprfi
kqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidiyrtlh
pksteytffsaphhtyskidhivgskallskckrteiitnylsdhsaiklelr

SCOP Domain Coordinates for d1vybb_:

Click to download the PDB-style file with coordinates for d1vybb_.
(The format of our PDB-style files is described here.)

Timeline for d1vybb_: