Lineage for d1vyba_ (1vyb A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548549Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2548550Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2548551Family d.151.1.1: DNase I-like [56220] (7 proteins)
  6. 2548599Protein Endonuclease domain of LINE-1 reverse transcriptase homolog [111211] (1 species)
  7. 2548600Species Human (Homo sapiens) [TaxId:9606] [111212] (1 PDB entry)
    Uniprot P08547 2-237
  8. 2548601Domain d1vyba_: 1vyb A: [108897]
    complexed with gol, so3, so4

Details for d1vyba_

PDB Entry: 1vyb (more details), 1.8 Å

PDB Description: endonuclease domain of human line1 orf2p
PDB Compounds: (A:) orf2 contains a reverse transcriptase domain

SCOPe Domain Sequences for d1vyba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vyba_ d.151.1.1 (A:) Endonuclease domain of LINE-1 reverse transcriptase homolog {Human (Homo sapiens) [TaxId: 9606]}
gsnshitiltlninglnsaikrhrlaswiksqdpsvcciqethltcrdthrlkikgwrki
yqangkqkkagvailvsdktdfkptkikrdkeghyimvkgsiqqeeltilniyapntgap
rfikqvlsdlqrdldshtlimgdfntplstldrstrqkvnkdtqelnsalhqadlidiyr
tlhpksteytffsaphhtyskidhivgskallskckrteiitnylsdhsaiklelr

SCOPe Domain Coordinates for d1vyba_:

Click to download the PDB-style file with coordinates for d1vyba_.
(The format of our PDB-style files is described here.)

Timeline for d1vyba_: