SCOPe 2.05: Domain d1vmeb2: 1vme B:1-250

Lineage for d1vmeb2 (1vme B:1-250)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins)

6. Protein ROO-like flavoprotein TM0755, N-terminal domain [111225] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [111226] (1 PDB entry)
   Uniprot Q9WZL4 #

8. Domain d1vmeb2: 1vme B:1-250 [108896]
   Other proteins in same PDB: d1vmea1, d1vmeb1
   Structural genomics target
   complexed with cl, edo, feo

Details for d1vmeb2

PDB Entry: 1vme, 1.8 Å

PDB Description: Crystal structure of Flavoprotein (TM0755) from Thermotoga maritima at 1.80 A resolution

PDB Compounds: (B:) Flavoprotein

SCOPe Domain Sequences for d1vmeb2:

Sequence; same for both SEQRES and ATOM records:

>d1vmeb2 d.157.1.3 (B:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mpkiwterifddpeiyvlridddriryfeavweipegisynaylvklnganvlidgwkgn
yakefidalskivdpkeithiivnhtepdhsgslpatlktighdveiiasnfgkrllegf
ygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscdvgggyllpeild
dsnesvverylphvtkyivtvighyknyilegaeklsslkikallpghgliwkkdpqrll
nhyvsvakgd

Timeline for d1vmeb2:

• d1vmeb2 first appeared in SCOP 1.69
  
• d1vmeb2 appears in SCOPe 2.04
  
• d1vmeb2 appears in SCOPe 2.06
  
• d1vmeb2 appears in the current release, SCOPe 2.08