Lineage for d1vmeb2 (1vme B:1-250)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513372Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 513373Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (5 families) (S)
  5. 513436Family d.157.1.3: ROO N-terminal domain-like [56291] (2 proteins)
  6. 513437Protein ROO-like flavoprotein TM0755, N-terminal domain [111225] (1 species)
  7. 513438Species Thermotoga maritima [TaxId:243274] [111226] (1 PDB entry)
  8. 513440Domain d1vmeb2: 1vme B:1-250 [108896]
    Other proteins in same PDB: d1vmea1, d1vmeb1
    Structural genomics target

Details for d1vmeb2

PDB Entry: 1vme (more details), 1.8 Å

PDB Description: Crystal structure of Flavoprotein (TM0755) from Thermotoga maritima at 1.80 A resolution

SCOP Domain Sequences for d1vmeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmeb2 d.157.1.3 (B:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima}
mpkiwterifddpeiyvlridddriryfeavweipegisynaylvklnganvlidgwkgn
yakefidalskivdpkeithiivnhtepdhsgslpatlktighdveiiasnfgkrllegf
ygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscdvgggyllpeild
dsnesvverylphvtkyivtvighyknyilegaeklsslkikallpghgliwkkdpqrll
nhyvsvakgd

SCOP Domain Coordinates for d1vmeb2:

Click to download the PDB-style file with coordinates for d1vmeb2.
(The format of our PDB-style files is described here.)

Timeline for d1vmeb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vmeb1