Lineage for d1vmeb1 (1vme B:251-398)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 481069Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 481332Superfamily c.23.5: Flavoproteins [52218] (7 families) (S)
  5. 481333Family c.23.5.1: Flavodoxin-related [52219] (4 proteins)
    binds FMN
  6. 481410Protein ROO-like flavoprotein TM0755, C-terminal domain [110466] (1 species)
  7. 481411Species Thermotoga maritima [TaxId:243274] [110467] (1 PDB entry)
  8. 481413Domain d1vmeb1: 1vme B:251-398 [108895]
    Other proteins in same PDB: d1vmea2, d1vmeb2
    Structural genomics target

Details for d1vmeb1

PDB Entry: 1vme (more details), 1.8 Å

PDB Description: Crystal structure of Flavoprotein (TM0755) from Thermotoga maritima at 1.80 A resolution

SCOP Domain Sequences for d1vmeb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmeb1 c.23.5.1 (B:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima}
pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea
lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwapsaertagellketkfri
lsfteikgsnmderkieeaisllkkele

SCOP Domain Coordinates for d1vmeb1:

Click to download the PDB-style file with coordinates for d1vmeb1.
(The format of our PDB-style files is described here.)

Timeline for d1vmeb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vmeb2