SCOPe 2.08: Domain d1vmeb1: 1vme B:251-398

Lineage for d1vmeb1 (1vme B:251-398)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
   binds FMN

6. Protein ROO-like flavoprotein TM0755, C-terminal domain [110466] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [110467] (1 PDB entry)
   Uniprot Q9WZL4

8. Domain d1vmeb1: 1vme B:251-398 [108895]
   Other proteins in same PDB: d1vmea2, d1vmea3, d1vmeb2, d1vmeb3
   Structural genomics target
   complexed with cl, edo, feo

Details for d1vmeb1

PDB Entry: 1vme, 1.8 Å

PDB Description: Crystal structure of Flavoprotein (TM0755) from Thermotoga maritima at 1.80 A resolution

PDB Compounds: (B:) Flavoprotein

SCOPe Domain Sequences for d1vmeb1:

Sequence; same for both SEQRES and ATOM records:

>d1vmeb1 c.23.5.1 (B:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea
lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwapsaertagellketkfri
lsfteikgsnmderkieeaisllkkele

Timeline for d1vmeb1:

• d1vmeb1 first appeared in SCOP 1.69
  
• d1vmeb1 appears in SCOPe 2.07