Lineage for d1vmea2 (1vme A:1-250)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603336Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins)
  6. 2603351Protein ROO-like flavoprotein TM0755, N-terminal domain [111225] (1 species)
  7. 2603352Species Thermotoga maritima [TaxId:2336] [111226] (1 PDB entry)
    Uniprot Q9WZL4 #
  8. 2603353Domain d1vmea2: 1vme A:1-250 [108894]
    Other proteins in same PDB: d1vmea1, d1vmea3, d1vmeb1, d1vmeb3
    Structural genomics target
    complexed with cl, edo, feo

Details for d1vmea2

PDB Entry: 1vme (more details), 1.8 Å

PDB Description: Crystal structure of Flavoprotein (TM0755) from Thermotoga maritima at 1.80 A resolution
PDB Compounds: (A:) Flavoprotein

SCOPe Domain Sequences for d1vmea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mpkiwterifddpeiyvlridddriryfeavweipegisynaylvklnganvlidgwkgn
yakefidalskivdpkeithiivnhtepdhsgslpatlktighdveiiasnfgkrllegf
ygikdvtvvkdgeereiggkkfkfvmtpwlhwpdtmvtyldgilfscdvgggyllpeild
dsnesvverylphvtkyivtvighyknyilegaeklsslkikallpghgliwkkdpqrll
nhyvsvakgd

SCOPe Domain Coordinates for d1vmea2:

Click to download the PDB-style file with coordinates for d1vmea2.
(The format of our PDB-style files is described here.)

Timeline for d1vmea2: