Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
Protein ROO-like flavoprotein TM0755, C-terminal domain [110466] (1 species) |
Species Thermotoga maritima [TaxId:2336] [110467] (1 PDB entry) Uniprot Q9WZL4 |
Domain d1vmea1: 1vme A:251-398 [108893] Other proteins in same PDB: d1vmea2, d1vmea3, d1vmeb2, d1vmeb3 Structural genomics target complexed with cl, edo, feo |
PDB Entry: 1vme (more details), 1.8 Å
SCOPe Domain Sequences for d1vmea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} pkkgkvtviydsmygfvenvmkkaidslkekgftpvvykfsdeerpaiseilkdipdsea lifgvstyeaeihplmrftlleiidkanyekpvlvfgvhgwapsaertagellketkfri lsfteikgsnmderkieeaisllkkele
Timeline for d1vmea1: