Lineage for d1vmda_ (1vmd A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1840981Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 1840982Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 1841026Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins)
  6. 1841027Protein Methylglyoxal synthase, MgsA [52340] (3 species)
  7. 1841056Species Thermotoga maritima [TaxId:2336] [110489] (1 PDB entry)
    Uniprot Q9X0R7 #
  8. 1841057Domain d1vmda_: 1vmd A: [108891]
    Structural genomics target
    complexed with cl, so4

Details for d1vmda_

PDB Entry: 1vmd (more details), 2.06 Å

PDB Description: Crystal structure of Methylglyoxal synthase (TM1185) from Thermotoga maritima at 2.06 A resolution
PDB Compounds: (A:) methylglyoxal synthase

SCOPe Domain Sequences for d1vmda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmda_ c.24.1.2 (A:) Methylglyoxal synthase, MgsA {Thermotoga maritima [TaxId: 2336]}
prrykifmdkkkrialiahdrrkrdllewvsfnlgtlskhelyatgttgallqeklglkv
hrlksgplggdqqigamiaegkidvliffwdplepqahdvdvkaliriatvynipvaitr
stadflissplmndvyekiqidyeeelerrirkvve

SCOPe Domain Coordinates for d1vmda_:

Click to download the PDB-style file with coordinates for d1vmda_.
(The format of our PDB-style files is described here.)

Timeline for d1vmda_: