SCOPe 2.07: Domain d1vmab2: 1vma B:82-294

Lineage for d1vmab2 (1vma B:82-294)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [110550] (1 PDB entry)
   Uniprot Q9WZ40

8. Domain d1vmab2: 1vma B:82-294 [108890]
   Other proteins in same PDB: d1vmaa1, d1vmab1
   Structural genomics target
   complexed with cit, mg

Details for d1vmab2

PDB Entry: 1vma, 1.6 Å

PDB Description: Crystal structure of Cell division protein ftsY (TM0570) from Thermotoga maritima at 1.60 A resolution

PDB Compounds: (B:) cell division protein ftsy

SCOPe Domain Sequences for d1vmab2:

Sequence; same for both SEQRES and ATOM records:

>d1vmab2 c.37.1.10 (B:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}
dtklnvppeppfvimvvgvngtgkttscgklakmfvdegksvvlaaadtfraaaieqlki
wgervgatvishsegadpaavafdavahalarnkdvviidtagrlhtkknlmeelrkvhr
vvkkkipdaphetllvidattgqnglvqakifkeavnvtgiiltkldgtakggitlaiar
elgipikfigvgekaedlrpfdpeafvevllse

Timeline for d1vmab2:

• d1vmab2 first appeared in SCOP 1.69
  
• d1vmab2 appears in SCOPe 2.06
  
• d1vmab2 appears in the current release, SCOPe 2.08