![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) ![]() |
![]() | Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
![]() | Protein Signal recognition particle receptor, FtsY [47368] (3 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [109766] (1 PDB entry) Uniprot Q9WZ40 |
![]() | Domain d1vmaa1: 1vma A:1-81 [108887] Other proteins in same PDB: d1vmaa2, d1vmab2 Structural genomics target complexed with cit, mg |
PDB Entry: 1vma (more details), 1.6 Å
SCOPe Domain Sequences for d1vmaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vmaa1 a.24.13.1 (A:1-81) Signal recognition particle receptor, FtsY {Thermotoga maritima [TaxId: 2336]} mglfdflkkglqktketffgrvvkllkgkklddetreeleelliqadvgvetteyilerl eekdgdaleslkeiileilnf
Timeline for d1vmaa1: