SCOPe 2.05: Domain d1vmaa1: 1vma A:1-81

Lineage for d1vmaa1 (1vma A:1-81)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal recognition particle receptor, FtsY [47368] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [109766] (1 PDB entry)
   Uniprot Q9WZ40

8. Domain d1vmaa1: 1vma A:1-81 [108887]
   Other proteins in same PDB: d1vmaa2, d1vmab2
   Structural genomics target
   complexed with cit, mg

Details for d1vmaa1

PDB Entry: 1vma, 1.6 Å

PDB Description: Crystal structure of Cell division protein ftsY (TM0570) from Thermotoga maritima at 1.60 A resolution

PDB Compounds: (A:) cell division protein ftsy

SCOPe Domain Sequences for d1vmaa1:

Sequence; same for both SEQRES and ATOM records:

>d1vmaa1 a.24.13.1 (A:1-81) Signal recognition particle receptor, FtsY {Thermotoga maritima [TaxId: 2336]}
mglfdflkkglqktketffgrvvkllkgkklddetreeleelliqadvgvetteyilerl
eekdgdaleslkeiileilnf

Timeline for d1vmaa1:

• d1vmaa1 first appeared in SCOP 1.69
  
• d1vmaa1 appears in SCOPe 2.04
  
• d1vmaa1 appears in SCOPe 2.06
  
• d1vmaa1 appears in the current release, SCOPe 2.08