Lineage for d1vmaa1 (1vma A:1-81)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987995Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 1987996Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 protein domains)
  6. 1988000Protein Signal recognition particle receptor, FtsY [47368] (3 species)
  7. 1988004Species Thermotoga maritima [TaxId:2336] [109766] (1 PDB entry)
    Uniprot Q9WZ40
  8. 1988005Domain d1vmaa1: 1vma A:1-81 [108887]
    Other proteins in same PDB: d1vmaa2, d1vmab2
    Structural genomics target
    complexed with cit, mg

Details for d1vmaa1

PDB Entry: 1vma (more details), 1.6 Å

PDB Description: Crystal structure of Cell division protein ftsY (TM0570) from Thermotoga maritima at 1.60 A resolution
PDB Compounds: (A:) cell division protein ftsy

SCOPe Domain Sequences for d1vmaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vmaa1 a.24.13.1 (A:1-81) Signal recognition particle receptor, FtsY {Thermotoga maritima [TaxId: 2336]}
mglfdflkkglqktketffgrvvkllkgkklddetreeleelliqadvgvetteyilerl
eekdgdaleslkeiileilnf

SCOPe Domain Coordinates for d1vmaa1:

Click to download the PDB-style file with coordinates for d1vmaa1.
(The format of our PDB-style files is described here.)

Timeline for d1vmaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vmaa2