Lineage for d1vm9a_ (1vm9 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1782956Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1782957Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1782958Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)
  6. 1783029Protein Toluene-4-monooxygenase system protein C, TmoC [110154] (1 species)
  7. 1783030Species Pseudomonas mendocina [TaxId:300] [110155] (5 PDB entries)
    Uniprot Q00458
  8. 1783031Domain d1vm9a_: 1vm9 A: [108886]
    complexed with edo, fes, mg; mutant

Details for d1vm9a_

PDB Entry: 1vm9 (more details), 1.48 Å

PDB Description: the x-ray structure of the cys84ala cys85ala double mutant of the [2fe-2s] ferredoxin subunit of toluene-4-monooxygenase from pseudomonas mendocina kr1
PDB Compounds: (A:) Toluene-4-monooxygenase system protein C

SCOPe Domain Sequences for d1vm9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vm9a_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]}
sfekicslddiwvgemetfetsdgtevlivnseehgvkayqamcphqeillsegsyeggv
itcrahlwtfndgtghginpddaalaeypvevkgddiyvstkgilpnka

SCOPe Domain Coordinates for d1vm9a_:

Click to download the PDB-style file with coordinates for d1vm9a_.
(The format of our PDB-style files is described here.)

Timeline for d1vm9a_: