Lineage for d1vm7b_ (1vm7 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2904325Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2904326Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2904327Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 2904399Protein Ribokinase [53615] (3 species)
  7. 2904449Species Thermotoga maritima [TaxId:2336] [110706] (1 PDB entry)
    Uniprot Q9X055
  8. 2904451Domain d1vm7b_: 1vm7 B: [108885]
    Structural genomics target

Details for d1vm7b_

PDB Entry: 1vm7 (more details), 2.15 Å

PDB Description: Crystal structure of Ribokinase (TM0960) from Thermotoga maritima at 2.15 A resolution
PDB Compounds: (B:) ribokinase

SCOPe Domain Sequences for d1vm7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vm7b_ c.72.1.1 (B:) Ribokinase {Thermotoga maritima [TaxId: 2336]}
flvisvvgssnidivlkvdhftkpgetqkaiemnvfpggkganqavtvakigekgcrfvt
cignddysdllienyeklgitgyirvslptgrafievdktgqnriiifpganaelkkeli
dwntlsesdilllqneipfettlecakrfngivifdpapaqgineeifqyldyltpneke
iealskdffgefltvekaaekflelgvknvivklgdkgvllvnknekkhfptfkvkavdt
taagdvfngafavalsegknpeeavifgtaaaaisvtrlgaqssipareeveaflkn

SCOPe Domain Coordinates for d1vm7b_:

Click to download the PDB-style file with coordinates for d1vm7b_.
(The format of our PDB-style files is described here.)

Timeline for d1vm7b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vm7a_