![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.68: IF3-like [55199] (7 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.6: AlbA-like [82704] (2 families) ![]() |
![]() | Family d.68.6.2: Hypothetical protein At2g34160 [111027] (1 protein) |
![]() | Protein Hypothetical protein At2g34160 [111028] (1 species) |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111029] (1 PDB entry) |
![]() | Domain d1vm0b_: 1vm0 B: [108874] Structural genomics target |
PDB Entry: 1vm0 (more details), 1.8 Å
SCOP Domain Sequences for d1vm0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vm0b_ d.68.6.2 (B:) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana)} knriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekki mtsivdikddargrpvqkakieitlvksekfdelmaaaneeke
Timeline for d1vm0b_: