Lineage for d1vm0a_ (1vm0 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1912692Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 1913007Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 1913046Family d.68.6.2: Hypothetical protein At2g34160 [111027] (2 proteins)
  6. 1913047Protein Hypothetical protein At2g34160 [111028] (1 species)
  7. 1913048Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111029] (1 PDB entry)
    Uniprot O22969 19-117
  8. 1913049Domain d1vm0a_: 1vm0 A: [108873]
    Structural genomics target
    complexed with k, no3

Details for d1vm0a_

PDB Entry: 1vm0 (more details), 1.8 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at2g34160
PDB Compounds: (A:) unknown protein

SCOPe Domain Sequences for d1vm0a_:

Sequence, based on SEQRES records: (download)

>d1vm0a_ d.68.6.2 (A:) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk
imtsivdikddargrpvqkakieitlvksekfdelmaaa

Sequence, based on observed residues (ATOM records): (download)

>d1vm0a_ d.68.6.2 (A:) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk
imtsivdikpvqkakieitlvksekfdelmaaa

SCOPe Domain Coordinates for d1vm0a_:

Click to download the PDB-style file with coordinates for d1vm0a_.
(The format of our PDB-style files is described here.)

Timeline for d1vm0a_: