Lineage for d1vm0a_ (1vm0 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864751Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 864892Superfamily d.68.6: AlbA-like [82704] (2 families) (S)
  5. 864914Family d.68.6.2: Hypothetical protein At2g34160 [111027] (1 protein)
  6. 864915Protein Hypothetical protein At2g34160 [111028] (1 species)
  7. 864916Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111029] (2 PDB entries)
    Uniprot O22969 19-117
  8. 864917Domain d1vm0a_: 1vm0 A: [108873]
    Structural genomics target

Details for d1vm0a_

PDB Entry: 1vm0 (more details), 1.8 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at2g34160
PDB Compounds: (A:) unknown protein

SCOP Domain Sequences for d1vm0a_:

Sequence, based on SEQRES records: (download)

>d1vm0a_ d.68.6.2 (A:) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk
imtsivdikddargrpvqkakieitlvksekfdelmaaa

Sequence, based on observed residues (ATOM records): (download)

>d1vm0a_ d.68.6.2 (A:) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk
imtsivdikpvqkakieitlvksekfdelmaaa

SCOP Domain Coordinates for d1vm0a_:

Click to download the PDB-style file with coordinates for d1vm0a_.
(The format of our PDB-style files is described here.)

Timeline for d1vm0a_: