SCOP 1.73: Domain d1vm0a_: 1vm0 A:

Lineage for d1vm0a_ (1vm0 A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.68: IF3-like [55199] (7 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.6: AlbA-like [82704] (2 families)

5. Family d.68.6.2: Hypothetical protein At2g34160 [111027] (1 protein)

6. Protein Hypothetical protein At2g34160 [111028] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [111029] (2 PDB entries)

8. Domain d1vm0a_: 1vm0 A: [108873]

Details for d1vm0a_

PDB Entry: 1vm0, 1.8 Å

PDB Description: x-ray structure of gene product from arabidopsis thaliana at2g34160

PDB Compounds: (A:) unknown protein

SCOP Domain Sequences for d1vm0a_:

Sequence, based on SEQRES records:

>d1vm0a_ d.68.6.2 (A:) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk
imtsivdikddargrpvqkakieitlvksekfdelmaaa

Sequence, based on observed residues (ATOM records):

>d1vm0a_ d.68.6.2 (A:) Hypothetical protein At2g34160 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kknriqvsntkkplffyvnlakrymqqyndvelsalgmaiatvvtvteilknngfavekk
imtsivdikpvqkakieitlvksekfdelmaaa

Timeline for d1vm0a_:

• d1vm0a_ first appeared in SCOP 1.69
  
• d1vm0a_ appears in SCOP 1.71
  
• d1vm0a_ appears in SCOP 1.75
  
• d1vm0a_ appears in the current release, SCOPe 2.08