SCOPe 2.05: Domain d1vlya1: 1vly A:244-325

Lineage for d1vlya1 (1vly A:244-325)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families)

5. Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)

6. Protein Hypothetical protein YgfZ, C-terminal domain [101794] (1 species)

7. Species Escherichia coli [TaxId:562] [101795] (2 PDB entries)
   Uniprot P39179

8. Domain d1vlya1: 1vly A:244-325 [108871]
   Other proteins in same PDB: d1vlya2
   Structural genomics target
   complexed with act, ca, cl, edo

Details for d1vlya1

PDB Entry: 1vly, 1.3 Å

PDB Description: Crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 A resolution

PDB Compounds: (A:) Unknown protein from 2D-page

SCOPe Domain Sequences for d1vlya1:

Sequence; same for both SEQRES and ATOM records:

>d1vlya1 b.44.2.1 (A:244-325) Hypothetical protein YgfZ, C-terminal domain {Escherichia coli [TaxId: 562]}
nkralwllagsasrlpeagedlelkmgenwrrtgtvlaavkledgqvvvqvvmnndmepd
sifrvrddantlhieplpysle

Timeline for d1vlya1:

• d1vlya1 first appeared in SCOP 1.69
  
• d1vlya1 appears in SCOPe 2.04
  
• d1vlya1 appears in SCOPe 2.06
  
• d1vlya1 appears in the current release, SCOPe 2.08