Class b: All beta proteins [48724] (176 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) |
Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins) |
Protein Hypothetical protein YgfZ, C-terminal domain [101794] (1 species) |
Species Escherichia coli [TaxId:562] [101795] (2 PDB entries) Uniprot P39179 |
Domain d1vlya1: 1vly A:244-325 [108871] Other proteins in same PDB: d1vlya2 Structural genomics target complexed with act, ca, cl, edo |
PDB Entry: 1vly (more details), 1.3 Å
SCOPe Domain Sequences for d1vlya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlya1 b.44.2.1 (A:244-325) Hypothetical protein YgfZ, C-terminal domain {Escherichia coli [TaxId: 562]} nkralwllagsasrlpeagedlelkmgenwrrtgtvlaavkledgqvvvqvvmnndmepd sifrvrddantlhieplpysle
Timeline for d1vlya1: