Lineage for d1vlya1 (1vly A:244-325)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317759Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1317856Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families) (S)
  5. 1317857Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)
  6. 1317872Protein Hypothetical protein YgfZ, C-terminal domain [101794] (1 species)
  7. 1317873Species Escherichia coli [TaxId:562] [101795] (2 PDB entries)
    Uniprot P39179
  8. 1317874Domain d1vlya1: 1vly A:244-325 [108871]
    Other proteins in same PDB: d1vlya2
    Structural genomics target
    complexed with act, ca, cl, edo

Details for d1vlya1

PDB Entry: 1vly (more details), 1.3 Å

PDB Description: Crystal structure of a putative aminomethyltransferase (ygfz) from escherichia coli at 1.30 A resolution
PDB Compounds: (A:) Unknown protein from 2D-page

SCOPe Domain Sequences for d1vlya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlya1 b.44.2.1 (A:244-325) Hypothetical protein YgfZ, C-terminal domain {Escherichia coli [TaxId: 562]}
nkralwllagsasrlpeagedlelkmgenwrrtgtvlaavkledgqvvvqvvmnndmepd
sifrvrddantlhieplpysle

SCOPe Domain Coordinates for d1vlya1:

Click to download the PDB-style file with coordinates for d1vlya1.
(The format of our PDB-style files is described here.)

Timeline for d1vlya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vlya2