Lineage for d1vlva1 (1vlv A:1-152)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2513848Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2513849Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2513850Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins)
  6. 2514165Protein Ornithine transcarbamoylase [53676] (6 species)
  7. 2514243Species Thermotoga maritima [TaxId:2336] [110720] (1 PDB entry)
    Uniprot P96108
  8. 2514244Domain d1vlva1: 1vlv A:1-152 [108866]
    Other proteins in same PDB: d1vlva3
    Structural genomics target
    complexed with po4

Details for d1vlva1

PDB Entry: 1vlv (more details), 2.25 Å

PDB Description: Crystal structure of Ornithine carbamoyltransferase (TM1097) from Thermotoga maritima at 2.25 A resolution
PDB Compounds: (A:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d1vlva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlva1 c.78.1.1 (A:1-152) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]}
msvnlkgrslltlldfspeeirylldiskqvkmenrsklrterfkgmtlamifekrstrt
rlafetafaeegghpiflspndihlgakesledtarvlgrmvdaimfrgykqetveklae
ysgvpvyngltdefhptqaladlmtieenfgr

SCOPe Domain Coordinates for d1vlva1:

Click to download the PDB-style file with coordinates for d1vlva1.
(The format of our PDB-style files is described here.)

Timeline for d1vlva1: