Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
Protein Ornithine transcarbamoylase [53676] (6 species) |
Species Thermotoga maritima [TaxId:2336] [110720] (1 PDB entry) Uniprot P96108 |
Domain d1vlva1: 1vlv A:1-152 [108866] Other proteins in same PDB: d1vlva3 Structural genomics target complexed with po4 |
PDB Entry: 1vlv (more details), 2.25 Å
SCOPe Domain Sequences for d1vlva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlva1 c.78.1.1 (A:1-152) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} msvnlkgrslltlldfspeeirylldiskqvkmenrsklrterfkgmtlamifekrstrt rlafetafaeegghpiflspndihlgakesledtarvlgrmvdaimfrgykqetveklae ysgvpvyngltdefhptqaladlmtieenfgr
Timeline for d1vlva1: