Lineage for d1vlub1 (1vlu B:1-435)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140961Protein Gamma-glutamyl phosphate reductase [89781] (2 species)
  7. 2140962Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110731] (1 PDB entry)
    Uniprot P54885
  8. 2140964Domain d1vlub1: 1vlu B:1-435 [108865]
    Other proteins in same PDB: d1vlua2, d1vlub2
    Structural genomics target
    complexed with cl

Details for d1vlub1

PDB Entry: 1vlu (more details), 2.29 Å

PDB Description: Crystal structure of Gamma-glutamyl phosphate reductase (yor323c) from Saccharomyces cerevisiae at 2.40 A resolution
PDB Compounds: (B:) Gamma-glutamyl phosphate reductase

SCOPe Domain Sequences for d1vlub1:

Sequence, based on SEQRES records: (download)

>d1vlub1 c.82.1.1 (B:1-435) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msssqqiaknarkagnilktisnegrsdilykihdalkanahaieeankidlavaketgl
adsllkrldlfkgdkfevmlqgikdvaeledpvgkvkmarelddgltlyqvtapvgvllv
ifesrpevianitalsiksgnaailkggkesvntfremakivndtiaqfqsetgvpvgsv
qlietrqdvsdlldqdeyidlvvprgsnalvrkikdttkipvlghadgicsiyldedadl
ikakrisldaktnypagcnametllinpkfskwwevlenltleggvtihatkdlktayfd
klnelgklteaiqcktvdadeeqdfdkeflsldlaakfvtstesaiqhinthssrhtdai
vtenkanaekfmkgvdssgvywnastrfadgfrygfgaevgistskihargpvgldglvs
yqyqirgdgqvasdy

Sequence, based on observed residues (ATOM records): (download)

>d1vlub1 c.82.1.1 (B:1-435) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msssqqiaknarkagnilktisnegrsdilykihdalkanahaieeankidlavaketgl
adsllkrldlfkgdkfevmlqgikdvaeledpvgkvkmarelddgltlyqvtapvgvllv
ifesrpevianitalsiksgnaailkggkesvntfremakivndtiaqfqsetgvpvgsv
qlietdvsdlldqdeyidlvvprgsnalvrkikdttkipvlghadgicsiyldedadlik
akrisldaktnnametllinpkfskwwevlenltleggvtihatkdlktayfdklnelgk
lteaiqcktvdadsldlaakfvtstesaiqhinthssrhtdaivtenkanaekfmkgvds
sgvywnastrfadggldglvsyqyqirgdgqvasdy

SCOPe Domain Coordinates for d1vlub1:

Click to download the PDB-style file with coordinates for d1vlub1.
(The format of our PDB-style files is described here.)

Timeline for d1vlub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vlub2