Lineage for d1vlua_ (1vlu A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 493759Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 493760Superfamily c.82.1: ALDH-like [53720] (2 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 493761Family c.82.1.1: ALDH-like [53721] (4 proteins)
  6. 493910Protein Gamma-glutamyl phosphate reductase [89781] (2 species)
  7. 493911Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110731] (1 PDB entry)
  8. 493912Domain d1vlua_: 1vlu A: [108864]

Details for d1vlua_

PDB Entry: 1vlu (more details), 2.29 Å

PDB Description: Crystal structure of Gamma-glutamyl phosphate reductase (yor323c) from Saccharomyces cerevisiae at 2.40 A resolution

SCOP Domain Sequences for d1vlua_:

Sequence, based on SEQRES records: (download)

>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae)}
hmsssqqiaknarkagnilktisnegrsdilykihdalkanahaieeankidlavaketg
ladsllkrldlfkgdkfevmlqgikdvaeledpvgkvkmarelddgltlyqvtapvgvll
vifesrpevianitalsiksgnaailkggkesvntfremakivndtiaqfqsetgvpvgs
vqlietrqdvsdlldqdeyidlvvprgsnalvrkikdttkipvlghadgicsiyldedad
likakrisldaktnypagcnametllinpkfskwwevlenltleggvtihatkdlktayf
dklnelgklteaiqcktvdadeeqdfdkeflsldlaakfvtstesaiqhinthssrhtda
ivtenkanaekfmkgvdssgvywnastrfadgfrygfgaevgistskihargpvgldglv
syqyqirgdgqvasdy

Sequence, based on observed residues (ATOM records): (download)

>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae)}
hmsssqqiaknarkagnilktisnegrsdilykihdalkanahaieeankidlavaketg
ladsllkrldlfkgdkfevmlqgikdvaeledpvgkvkmarelddgltlyqvtapvgvll
vifesrpevianitalsiksgnaailkggkesvntfremakivndtiaqfqsetgvpvgs
vqlietrvsdlldqdeyidlvvprgsnalvrkikdttkipvlghadgicsiyldedadli
kakrisldaktncnametllinpkfskwwevlenltleggvtihatkdlktayfdklnel
gklteaiqcktvsldlaakfvtstesaiqhinthssrhtdaivtenkanaekfmkgvdss
gvywnastrfadvgldglvsyqyqirgdgqvasdy

SCOP Domain Coordinates for d1vlua_:

Click to download the PDB-style file with coordinates for d1vlua_.
(The format of our PDB-style files is described here.)

Timeline for d1vlua_: