Lineage for d1vlrb2 (1vlr B:39-145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008663Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily)
    beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a
  4. 3008664Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families) (S)
    forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4]
    automatically mapped to Pfam PF05652
  5. 3008665Family d.246.1.1: mRNA decapping enzyme DcpS N-terminal domain [102861] (1 protein)
  6. 3008666Protein mRNA decapping enzyme DcpS N-terminal domain [102862] (2 species)
  7. 3008678Species Mouse (Mus musculus) [TaxId:10090] [110868] (1 PDB entry)
    Uniprot Q9DAR7
  8. 3008680Domain d1vlrb2: 1vlr B:39-145 [108863]
    Other proteins in same PDB: d1vlra1, d1vlrb1
    Structural genomics target
    complexed with edo

Details for d1vlrb2

PDB Entry: 1vlr (more details), 1.83 Å

PDB Description: Crystal structure of mRNA decapping enzyme (DcpS) from Mus musculus at 1.83 A resolution
PDB Compounds: (B:) mRNA decapping enzyme

SCOPe Domain Sequences for d1vlrb2:

Sequence, based on SEQRES records: (download)

>d1vlrb2 d.246.1.1 (B:39-145) mRNA decapping enzyme DcpS N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
vrlpfsgfrvqkvlresardkiiflhgkvnedsgdthgedavvilektpfqvehvaqllt
gspelklqfsndiystynlfpprhlsdikttvvypatekhlqkymrq

Sequence, based on observed residues (ATOM records): (download)

>d1vlrb2 d.246.1.1 (B:39-145) mRNA decapping enzyme DcpS N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
vrlpfsgfrvqkvlresardkiiflhgkvneedavvilektpfqvehvaqlltgspelkl
qfsndiystynlfpprhlsdikttvvypatekhlqkymrq

SCOPe Domain Coordinates for d1vlrb2:

Click to download the PDB-style file with coordinates for d1vlrb2.
(The format of our PDB-style files is described here.)

Timeline for d1vlrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vlrb1