![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.246: mRNA decapping enzyme DcpS N-terminal domain [102859] (1 superfamily) beta(3)-alpha-beta(3)-alpha; 3 layers a/b/a |
![]() | Superfamily d.246.1: mRNA decapping enzyme DcpS N-terminal domain [102860] (2 families) ![]() forms swapped dimer with two 6-stranded antiparallel beta sheets; order 1236[5][4] automatically mapped to Pfam PF05652 |
![]() | Family d.246.1.1: mRNA decapping enzyme DcpS N-terminal domain [102861] (1 protein) |
![]() | Protein mRNA decapping enzyme DcpS N-terminal domain [102862] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [110868] (1 PDB entry) Uniprot Q9DAR7 |
![]() | Domain d1vlrb2: 1vlr B:39-145 [108863] Other proteins in same PDB: d1vlra1, d1vlrb1 Structural genomics target complexed with edo |
PDB Entry: 1vlr (more details), 1.83 Å
SCOPe Domain Sequences for d1vlrb2:
Sequence, based on SEQRES records: (download)
>d1vlrb2 d.246.1.1 (B:39-145) mRNA decapping enzyme DcpS N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} vrlpfsgfrvqkvlresardkiiflhgkvnedsgdthgedavvilektpfqvehvaqllt gspelklqfsndiystynlfpprhlsdikttvvypatekhlqkymrq
>d1vlrb2 d.246.1.1 (B:39-145) mRNA decapping enzyme DcpS N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} vrlpfsgfrvqkvlresardkiiflhgkvneedavvilektpfqvehvaqlltgspelkl qfsndiystynlfpprhlsdikttvvypatekhlqkymrq
Timeline for d1vlrb2: