Lineage for d1vlra1 (1vlr A:146-337)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 499160Fold d.13: HIT-like [54196] (2 superfamilies)
    alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha
  4. 499161Superfamily d.13.1: HIT-like [54197] (3 families) (S)
  5. 499231Family d.13.1.3: mRNA decapping enzyme DcpS C-terminal domain [102745] (1 protein)
  6. 499232Protein mRNA decapping enzyme DcpS C-terminal domain [102746] (2 species)
  7. 499238Species Mouse (Mus musculus) [TaxId:10090] [110789] (1 PDB entry)
  8. 499239Domain d1vlra1: 1vlr A:146-337 [108860]
    Other proteins in same PDB: d1vlra2, d1vlrb2

Details for d1vlra1

PDB Entry: 1vlr (more details), 1.83 Å

PDB Description: Crystal structure of mRNA decapping enzyme (DcpS) from Mus musculus at 1.83 A resolution

SCOP Domain Sequences for d1vlra1:

Sequence, based on SEQRES records: (download)

>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus)}
dlrliretgddyrtitlpylesqslsiqwvynildkkaeadrivfenpdpsdgfvlipdl
kwnqqqlddlyliaichrrgirslrdltpehlpllrnilregqeailkryqvtgdrlrvy
lhylpsyyhlhvhftalgfeapgsgverahllaqvienlecdpkhyqqrtltfalrtddp
llqllqkaqqer

Sequence, based on observed residues (ATOM records): (download)

>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus)}
dlrliretgddyrtitlpylesqslsiqwvynildkdrivfenpdpsdgfvlipdlkwnq
qqlddlyliaichrrgirslrdltpehlpllrnilregqeailkryqvtgdrlrvylhyl
psyyhlhvhftalgfeapgsgverahllaqvienlecdpkhyqqrtltfalrtddpllql
lqkaqqer

SCOP Domain Coordinates for d1vlra1:

Click to download the PDB-style file with coordinates for d1vlra1.
(The format of our PDB-style files is described here.)

Timeline for d1vlra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vlra2