Lineage for d1vlqh_ (1vlq H:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 491701Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 491702Superfamily c.69.1: alpha/beta-Hydrolases [53474] (32 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 492327Family c.69.1.25: Acetyl xylan esterase-like (AXE1, Pfam 05448) [82504] (2 proteins)
  6. 492328Protein Acetyl xylan esterase TM0077 [110693] (1 species)
  7. 492329Species Thermotoga maritima [TaxId:243274] [110694] (1 PDB entry)
  8. 492337Domain d1vlqh_: 1vlq H: [108855]

Details for d1vlqh_

PDB Entry: 1vlq (more details), 2.1 Å

PDB Description: crystal structure of acetyl xylan esterase (tm0077) from thermotoga maritima at 2.10 a resolution

SCOP Domain Sequences for d1vlqh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlqh_ c.69.1.25 (H:) Acetyl xylan esterase TM0077 {Thermotoga maritima}
affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
nhegggsfqaveqvkflkklfe

SCOP Domain Coordinates for d1vlqh_:

Click to download the PDB-style file with coordinates for d1vlqh_.
(The format of our PDB-style files is described here.)

Timeline for d1vlqh_: