Lineage for d1vlqa_ (1vlq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901488Family c.69.1.25: Acetyl xylan esterase-like [82504] (3 proteins)
    Pfam PF05448; AXE1
  6. 2901489Protein Acetyl xylan esterase TM0077 [110693] (1 species)
  7. 2901490Species Thermotoga maritima [TaxId:2336] [110694] (5 PDB entries)
    Uniprot Q9WXT2
  8. 2901509Domain d1vlqa_: 1vlq A: [108848]
    Structural genomics target
    complexed with gol

Details for d1vlqa_

PDB Entry: 1vlq (more details), 2.1 Å

PDB Description: crystal structure of acetyl xylan esterase (tm0077) from thermotoga maritima at 2.10 a resolution
PDB Compounds: (A:) acetyl xylan esterase

SCOPe Domain Sequences for d1vlqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]}
affdlpleelkkyrperyeekdfdefweetlaesekfpldpvfermeshlktveaydvtf
sgyrgqrikgwllvpkleeeklpcvvqyigynggrgfphdwlfwpsmgyicfvmdtrgqg
sgwlkgdtpdypegpvdpqypgfmtrgildprtyyyrrvftdavraveaaasfpqvdqer
iviaggsqgggialavsalskkakallcdvpflchfrravqlvdthpyaeitnflkthrd
keeivfrtlsyfdgvnfaarakipalfsvglmdnicppstvfaaynyyagpkeiriypyn
nhegggsfqaveqvkflkklfe

SCOPe Domain Coordinates for d1vlqa_:

Click to download the PDB-style file with coordinates for d1vlqa_.
(The format of our PDB-style files is described here.)

Timeline for d1vlqa_: