Lineage for d1vlpd1 (1vlp D:1-149)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502780Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 502829Superfamily d.41.2: Nicotinate/Quinolinate PRTase C-terminal domain-like [54675] (3 families) (S)
  5. 502863Family d.41.2.2: Nicotinate phosphoribosyltransferase, N-terminal domain [110907] (1 protein)
  6. 502864Protein Nicotinate phosphoribosyltransferase, N-terminal domain [110908] (1 species)
  7. 502865Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110909] (1 PDB entry)
  8. 502869Domain d1vlpd1: 1vlp D:1-149 [108846]
    Other proteins in same PDB: d1vlpa2, d1vlpb2, d1vlpc2, d1vlpd2
    Structural genomics target

Details for d1vlpd1

PDB Entry: 1vlp (more details), 1.75 Å

PDB Description: crystal structure of a putative nicotinate phosphoribosyltransferase (yor209c, npt1) from saccharomyces cerevisiae at 1.75 a resolution

SCOP Domain Sequences for d1vlpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlpd1 d.41.2.2 (D:1-149) Nicotinate phosphoribosyltransferase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
msepvikslldtdmykitmhaavftnfpdvtvtykytnrssqltfnkeainwlkeqfsyl
gnlrfteeeieylkqeipylpsayikyisssnyklhpeeqisftseeiegkpthyklkil
vsgswkdtilyeipllsliseayfkfvdi

SCOP Domain Coordinates for d1vlpd1:

Click to download the PDB-style file with coordinates for d1vlpd1.
(The format of our PDB-style files is described here.)

Timeline for d1vlpd1: