SCOPe 2.08: Domain d1vlpc2: 1vlp C:150-415

Lineage for d1vlpc2 (1vlp C:150-415)

Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families)
incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
Family c.1.17.2: Nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (2 proteins)
automatically mapped to Pfam PF04095
Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (5 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110912] (1 PDB entry)
Uniprot P39683
Domain d1vlpc2: 1vlp C:150-415 [108845]
Other proteins in same PDB: d1vlpa1, d1vlpa3, d1vlpb1, d1vlpc1, d1vlpc3, d1vlpd1, d1vlpd3
Structural genomics target
complexed with cl, edo, mes, po4

Details for d1vlpc2

PDB Entry: 1vlp (more details), 1.75 Å

PDB Description: crystal structure of a putative nicotinate phosphoribosyltransferase (yor209c, npt1) from saccharomyces cerevisiae at 1.75 a resolution

PDB Compounds: (C:) Nicotinate phosphoribosyltransferase

SCOPe Domain Sequences for d1vlpc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlpc2 c.1.17.2 (C:150-415) Nicotinate phosphoribosyltransferase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dwdyenqleqaekkaetlfdngirfsefgtrrrrslkaqdlimqgimkavngnpdrnksl
llgtsnilfakkygvkpigtvahewvmgvasisedylhanknamdcwintfgaknaglal
tdtfgtddflksfrppysdayvgvrqdsgdpveytkkishhyhdvlklpkfskiicysds
lnvekaityshaakengmlatfgigtnftndfrkksepqvkseplnivikllevngnhai
kisdnlgknmgdpatvkrvkeelgyt

SCOPe Domain Coordinates for d1vlpc2:

Click to download the PDB-style file with coordinates for d1vlpc2.
(The format of our PDB-style files is described here.)

Timeline for d1vlpc2: