Lineage for d1vlpb2 (1vlp B:150-415)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 685496Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (2 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 685544Family c.1.17.2: Monomeric nicotinate phosphoribosyltransferase C-terminal domain [110910] (1 protein)
  6. 685545Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (3 species)
  7. 685549Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110912] (1 PDB entry)
  8. 685551Domain d1vlpb2: 1vlp B:150-415 [108843]
    Other proteins in same PDB: d1vlpa1, d1vlpb1, d1vlpc1, d1vlpd1

Details for d1vlpb2

PDB Entry: 1vlp (more details), 1.75 Å

PDB Description: crystal structure of a putative nicotinate phosphoribosyltransferase (yor209c, npt1) from saccharomyces cerevisiae at 1.75 a resolution
PDB Compounds: (B:) Nicotinate phosphoribosyltransferase

SCOP Domain Sequences for d1vlpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlpb2 c.1.17.2 (B:150-415) Nicotinate phosphoribosyltransferase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dwdyenqleqaekkaetlfdngirfsefgtrrrrslkaqdlimqgimkavngnpdrnksl
llgtsnilfakkygvkpigtvahewvmgvasisedylhanknamdcwintfgaknaglal
tdtfgtddflksfrppysdayvgvrqdsgdpveytkkishhyhdvlklpkfskiicysds
lnvekaityshaakengmlatfgigtnftndfrkksepqvkseplnivikllevngnhai
kisdnlgknmgdpatvkrvkeelgyt

SCOP Domain Coordinates for d1vlpb2:

Click to download the PDB-style file with coordinates for d1vlpb2.
(The format of our PDB-style files is described here.)

Timeline for d1vlpb2: