Lineage for d1vlpa2 (1vlp A:150-415)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839614Superfamily c.1.17: Nicotinate/Quinolinate PRTase C-terminal domain-like [51690] (3 families) (S)
    incomplete beta/alpha barrel with parallel beta-sheet of 7 strands
  5. 2839666Family c.1.17.2: Nicotinate phosphoribosyltransferase C-terminal domain-like [110910] (2 proteins)
    automatically mapped to Pfam PF04095
  6. 2839667Protein Nicotinate phosphoribosyltransferase, C-terminal domain [110911] (5 species)
  7. 2839671Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [110912] (1 PDB entry)
    Uniprot P39683
  8. 2839672Domain d1vlpa2: 1vlp A:150-415 [108841]
    Other proteins in same PDB: d1vlpa1, d1vlpa3, d1vlpb1, d1vlpc1, d1vlpc3, d1vlpd1, d1vlpd3
    Structural genomics target
    complexed with cl, edo, mes, po4

Details for d1vlpa2

PDB Entry: 1vlp (more details), 1.75 Å

PDB Description: crystal structure of a putative nicotinate phosphoribosyltransferase (yor209c, npt1) from saccharomyces cerevisiae at 1.75 a resolution
PDB Compounds: (A:) Nicotinate phosphoribosyltransferase

SCOPe Domain Sequences for d1vlpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlpa2 c.1.17.2 (A:150-415) Nicotinate phosphoribosyltransferase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dwdyenqleqaekkaetlfdngirfsefgtrrrrslkaqdlimqgimkavngnpdrnksl
llgtsnilfakkygvkpigtvahewvmgvasisedylhanknamdcwintfgaknaglal
tdtfgtddflksfrppysdayvgvrqdsgdpveytkkishhyhdvlklpkfskiicysds
lnvekaityshaakengmlatfgigtnftndfrkksepqvkseplnivikllevngnhai
kisdnlgknmgdpatvkrvkeelgyt

SCOPe Domain Coordinates for d1vlpa2:

Click to download the PDB-style file with coordinates for d1vlpa2.
(The format of our PDB-style files is described here.)

Timeline for d1vlpa2: