SCOPe 2.07: Domain d1vloa1: 1vlo A:278-364

Lineage for d1vloa1 (1vlo A:278-364)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.44.2: Aminomethyltransferase beta-barrel domain [101790] (2 families)

5. Family b.44.2.1: Aminomethyltransferase beta-barrel domain [101791] (3 proteins)

6. Protein Glycine cleavage system T protein, GcvT [110231] (4 species)

7. Species Escherichia coli [TaxId:562] [110233] (1 PDB entry)
   Uniprot P27248

8. Domain d1vloa1: 1vlo A:278-364 [108838]
   Other proteins in same PDB: d1vloa2, d1vloa3
   Structural genomics target

Details for d1vloa1

PDB Entry: 1vlo, 1.7 Å

PDB Description: Crystal structure of aminomethyltransferase (T protein; tetrahydrofolate-dependent) of glycine cleavage system (np417381) from Escherichia coli k12 at 1.70 A resolution

PDB Compounds: (A:) Aminomethyltransferase

SCOPe Domain Sequences for d1vloa1:

Sequence; same for both SEQRES and ATOM records:

>d1vloa1 b.44.2.1 (A:278-364) Glycine cleavage system T protein, GcvT {Escherichia coli [TaxId: 562]}
teklvglvmtekgvlrnelpvrftdaqgnqhegiitsgtfsptlgysialarvpegiget
aivqirnrempvkvtkpvfvrngkava

Timeline for d1vloa1:

• d1vloa1 first appeared in SCOP 1.69
  
• d1vloa1 appears in SCOPe 2.06
  
• d1vloa1 appears in the current release, SCOPe 2.08