Lineage for d1vlma1 (1vlm A:1-207)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130268Family c.66.1.41: UbiE/COQ5-like [110671] (5 protein domains)
    Pfam PF01209
  6. 2130293Protein Possible histamine N-methyltransferase TM1293 [110674] (1 species)
  7. 2130294Species Thermotoga maritima [TaxId:2336] [110675] (1 PDB entry)
    Uniprot Q9X119
  8. 2130295Domain d1vlma1: 1vlm A:1-207 [108836]
    Other proteins in same PDB: d1vlma2
    Structural genomics target
    complexed with na

Details for d1vlma1

PDB Entry: 1vlm (more details), 2.2 Å

PDB Description: Crystal structure of SAM-dependent methyltransferase, possible histamine N-methyltransferase (TM1293) from Thermotoga maritima at 2.20 A resolution
PDB Compounds: (A:) SAM-dependent methyltransferase

SCOPe Domain Sequences for d1vlma1:

Sequence, based on SEQRES records: (download)

>d1vlma1 c.66.1.41 (A:1-207) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]}
mwhiferfvneyerwflvhrfaylselqavkcllpegrgveigvgtgrfavplkikigve
psermaeiarkrgvfvlkgtaenlplkdesfdfalmvtticfvddperalkeayrilkkg
gylivgivdresflgreyeknkeksvfyknarffsteelmdlmrkagfeefkvvqtlfkh
pselseiepvkegygegafvvirgtkk

Sequence, based on observed residues (ATOM records): (download)

>d1vlma1 c.66.1.41 (A:1-207) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]}
mwhiferfvneyerwflvhrfaylselqavkcllpegrgveigvgtgrfavplkikigve
psermaeiarkrgvfvlkgtaenlplkdesfdfalmvtticfvddperalkeayrilkkg
gylivgivdresflgreyeknkekvfyknarffsteelmdlmrkagfeefkvvqtlfkhp
selseiepvkegygegafvvirgtkk

SCOPe Domain Coordinates for d1vlma1:

Click to download the PDB-style file with coordinates for d1vlma1.
(The format of our PDB-style files is described here.)

Timeline for d1vlma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vlma2
View in 3D
Domains from other chains:
(mouse over for more information)
d1vlmb_