Lineage for d1vlla_ (1vll A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 688681Family c.2.1.13: Ornithine cyclodeaminase-like [110436] (2 proteins)
    Pfam PF02423; contains additional alpha+beta dimerisation subdomain mostly formed by the N-terminal meander beta-sheet
  6. 688682Protein Archaeal alanine dehydrogenase [110437] (1 species)
  7. 688683Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [110438] (2 PDB entries)
  8. 688684Domain d1vlla_: 1vll A: [108834]

Details for d1vlla_

PDB Entry: 1vll (more details), 2.8 Å

PDB Description: Crystal structure of alanine dehydrogenase (AF1665) from Archaeoglobus fulgidus at 2.80 A resolution
PDB Compounds: (A:) alanine dehydrogenase

SCOP Domain Sequences for d1vlla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlla_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg
yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl
arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq
paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd
leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav
akvvyenalsknvgskikffr

SCOP Domain Coordinates for d1vlla_:

Click to download the PDB-style file with coordinates for d1vlla_.
(The format of our PDB-style files is described here.)

Timeline for d1vlla_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vllb_