SCOP 1.69: Domain d1vlla_: 1vll A:

Lineage for d1vlla_ (1vll A:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.13: Ornithine cyclodeaminase-like (Pfam 02423) [110436] (1 protein)
   contains additional alpha+beta dimerisation subdomain mostly formed by the N-terminal meander beta-sheet

6. Protein Archaeal alanine dehydrogenase [110437] (1 species)

7. Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [110438] (2 PDB entries)

8. Domain d1vlla_: 1vll A: [108834]

Details for d1vlla_

PDB Entry: 1vll, 2.8 Å

PDB Description: Crystal structure of alanine dehydrogenase (AF1665) from Archaeoglobus fulgidus at 2.80 A resolution

SCOP Domain Sequences for d1vlla_:

Sequence; same for both SEQRES and ATOM records:

>d1vlla_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus}
metliltqeeveslismdeamnaveeafrlyalgkaqmppkvylefekgdlrampahlmg
yaglkwvnshpgnpdkglptvmalmilnspetgfplavmdatyttslrtgaaggiaakyl
arknssvfgfigcgtqayfqlealrrvfdigevkaydvrekaakkfvsycedrgisasvq
paeeasrcdvlvtttpsrkpvvkaewveegthinaigadgpgkqeldveilkkakivvdd
leqakhggeinvavskgvigvedvhatigeviaglkdgresdeeitifdstglaiqdvav
akvvyenalsknvgskikffr

Timeline for d1vlla_:

• d1vlla_ is new in SCOP 1.69
  
• d1vlla_ appears in SCOP 1.71
  
• d1vlla_ appears in the current release, SCOPe 2.08