Lineage for d1vlia2 (1vli A:2-296)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086401Family c.1.10.6: NeuB-like [110368] (3 protein domains)
    Pfam PF03102
  6. 2086408Protein Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain [110369] (1 species)
  7. 2086409Species Bacillus subtilis [TaxId:1423] [110370] (1 PDB entry)
    Uniprot P39625
  8. 2086410Domain d1vlia2: 1vli A:2-296 [108831]
    Other proteins in same PDB: d1vlia1
    Structural genomics target
    complexed with zn

Details for d1vlia2

PDB Entry: 1vli (more details), 2.38 Å

PDB Description: crystal structure of spore coat polysaccharide biosynthesis protein spse (bsu37870) from bacillus subtilis at 2.38 a resolution
PDB Compounds: (A:) Spore coat polysaccharide biosynthesis protein spsE

SCOPe Domain Sequences for d1vlia2:

Sequence, based on SEQRES records: (download)

>d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
aafqianktvgkdapvfiiaeaginhdgkldqafalidaaaeagadavkfqmfqadrmyq
kdpglyktaagkdvsifslvqsmempaewilplldycrekqviflstvcdegsadllqst
spsafkiasyeinhlpllkyvarlnrpmifstagaeisdvheawrtiraegnnqiaimhc
vakypappeysnlsvipmlaaafpeavigfsdhsehpteapcaavrlgakliekhftidk
nlpgadhsfalnpdelkemvdgirkteaelkqgitkpvsekllgssyktttaieg

Sequence, based on observed residues (ATOM records): (download)

>d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]}
aafqianktvgkdapvfiiaeaginhdgkldqafalidaaaeagadavkfqmfqadrmyq
kdpdvsifslvqsmempaewilplldycrekqviflstvcdegsadllqstspsafkias
yeinhlpllkyvarlnrpmifstagaeisdvheawrtiraegnnqiaimhcvakypappe
ysnlsvipmlaaafpeavigfsdhsehpteapcaavrlgakliekhftidknlpgadhsf
alnpdelkemvdgirkteaelkqgitkpvsekllgssyktttaieg

SCOPe Domain Coordinates for d1vlia2:

Click to download the PDB-style file with coordinates for d1vlia2.
(The format of our PDB-style files is described here.)

Timeline for d1vlia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vlia1