Lineage for d1vlia1 (1vli A:297-368)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 471373Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 471374Superfamily b.85.1: AFP III-like domain (Pfam 01354) [51269] (1 family) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 471375Family b.85.1.1: AFP III-like domain (Pfam 01354) [51270] (2 proteins)
  6. 471376Protein Spore coat polysaccharide biosynthesis protein SpsE, C-terminal domain [110328] (1 species)
  7. 471377Species Bacillus subtilis [TaxId:1423] [110329] (1 PDB entry)
  8. 471378Domain d1vlia1: 1vli A:297-368 [108830]
    Other proteins in same PDB: d1vlia2
    Structural genomics target

Details for d1vlia1

PDB Entry: 1vli (more details), 2.38 Å

PDB Description: crystal structure of spore coat polysaccharide biosynthesis protein spse (bsu37870) from bacillus subtilis at 2.38 a resolution

SCOP Domain Sequences for d1vlia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlia1 b.85.1.1 (A:297-368) Spore coat polysaccharide biosynthesis protein SpsE, C-terminal domain {Bacillus subtilis}
eirnfayrgifttapiqkgeafsedniavlrpgqkpqglhprffelltsgvravrdipad
tgivwddillkd

SCOP Domain Coordinates for d1vlia1:

Click to download the PDB-style file with coordinates for d1vlia1.
(The format of our PDB-style files is described here.)

Timeline for d1vlia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vlia2