![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.1: AFP III-like domain [51269] (2 families) ![]() duplication: consists of two structural repeats related by pseudo dyad |
![]() | Family b.85.1.1: AFP III-like domain [51270] (4 proteins) Pfam PF01354 |
![]() | Protein Spore coat polysaccharide biosynthesis protein SpsE, C-terminal domain [110328] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [110329] (1 PDB entry) Uniprot P39625 |
![]() | Domain d1vlia1: 1vli A:297-368 [108830] Other proteins in same PDB: d1vlia2 Structural genomics target complexed with zn |
PDB Entry: 1vli (more details), 2.38 Å
SCOPe Domain Sequences for d1vlia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlia1 b.85.1.1 (A:297-368) Spore coat polysaccharide biosynthesis protein SpsE, C-terminal domain {Bacillus subtilis [TaxId: 1423]} eirnfayrgifttapiqkgeafsedniavlrpgqkpqglhprffelltsgvravrdipad tgivwddillkd
Timeline for d1vlia1: