Lineage for d1vlia1 (1vli A:297-368)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2072411Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2072412Superfamily b.85.1: AFP III-like domain [51269] (2 families) (S)
    duplication: consists of two structural repeats related by pseudo dyad
  5. 2072413Family b.85.1.1: AFP III-like domain [51270] (4 protein domains)
    Pfam PF01354
  6. 2072420Protein Spore coat polysaccharide biosynthesis protein SpsE, C-terminal domain [110328] (1 species)
  7. 2072421Species Bacillus subtilis [TaxId:1423] [110329] (1 PDB entry)
    Uniprot P39625
  8. 2072422Domain d1vlia1: 1vli A:297-368 [108830]
    Other proteins in same PDB: d1vlia2
    Structural genomics target
    complexed with zn

Details for d1vlia1

PDB Entry: 1vli (more details), 2.38 Å

PDB Description: crystal structure of spore coat polysaccharide biosynthesis protein spse (bsu37870) from bacillus subtilis at 2.38 a resolution
PDB Compounds: (A:) Spore coat polysaccharide biosynthesis protein spsE

SCOPe Domain Sequences for d1vlia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlia1 b.85.1.1 (A:297-368) Spore coat polysaccharide biosynthesis protein SpsE, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
eirnfayrgifttapiqkgeafsedniavlrpgqkpqglhprffelltsgvravrdipad
tgivwddillkd

SCOPe Domain Coordinates for d1vlia1:

Click to download the PDB-style file with coordinates for d1vlia1.
(The format of our PDB-style files is described here.)

Timeline for d1vlia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vlia2